PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25060.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 199aa    MW: 22876 Da    PI: 10.4384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25060.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-18450248
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             g+WTt+Ed +lvd+v+ +G g W++++++ g++R++k+c+ rw++yl
  mrna25060.1-v1.0-hybrid  4 GAWTTQEDNILVDYVETHGEGKWSKVSKETGLKRCGKSCRVRWLNYL 50
                             89*******************************************97 PP

2Myb_DNA-binding43.76.2e-1456130147
                              TSSS-HHHHHHHHHHHHHTTTT.............................-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.............................tWktIartmgkgRtlkqcksrwqky 47 
                              rg+ ++e+++l+ +++k+lG++                             +W++I+r+++ gRt+ ++k++w+++
  mrna25060.1-v1.0-hybrid  56 RGNISPEDEDLIMRLHKLLGNRsttafifryfvsslwidfvsaerktigicRWSLISRRLP-GRTDTEIKNHWNTV 130
                              7899*********************************************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.569154IPR017930Myb domain
SMARTSM007171.1E-13252IPR001005SANT/Myb domain
PfamPF002499.1E-17350IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-22457IPR009057Homeodomain-like
SuperFamilySSF466892.98E-21554IPR009057Homeodomain-like
CDDcd001676.82E-11550No hitNo description
PROSITE profilePS512949.15655135IPR017930Myb domain
SMARTSM007171.3E-1055133IPR001005SANT/Myb domain
PfamPF002499.1E-1156130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-1858134IPR009057Homeodomain-like
SuperFamilySSF466892.98E-21103132IPR009057Homeodomain-like
CDDcd001676.96E-6104131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MNTGAWTTQE DNILVDYVET HGEGKWSKVS KETGLKRCGK SCRVRWLNYL RSNIKRGNIS  60
PEDEDLIMRL HKLLGNRSTT AFIFRYFVSS LWIDFVSAER KTIGICRWSL ISRRLPGRTD  120
TEIKNHWNTV IRRRKIINSK KQCISENNKR NNKPSVGSSH LLLTDSDAVH TNPARIMKVG  180
KAVHQQSHND ENLETDVD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-20113425127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011461168.11e-115PREDICTED: transcription factor TT2-like
SwissprotQ9FJA27e-44TT2_ARATH; Transcription factor TT2
TrEMBLB5UAQ52e-50B5UAQ5_FAGCR; Transcription factor MYB558
STRINGSi008089m1e-46(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-45MYB family protein